Inflammatory Bowel Disease: Current Status and Future Approach : Proceedings of the International Symposium on Future Research Approaches to Inflammatory Bowel Disease, Mechanisms of Chronic Infection and Inflammation, Fort Lauderdale, Florida, USA, October 7-11, 1987Richard P. MacDermott |
From inside the book
Results 1-3 of 90
Page 81
... human B cells , and makes these cell transform and produce large amounts of immuno- globulins . By transforming human B lymphocytes of colonic mucosa or peripheral blood of patients with ulcerative colitis by EBV infection , it is ...
... human B cells , and makes these cell transform and produce large amounts of immuno- globulins . By transforming human B lymphocytes of colonic mucosa or peripheral blood of patients with ulcerative colitis by EBV infection , it is ...
Page 444
... human T200 show a remarkable conservation of this entire cytoplasmic region of the molecule . This almost certainly ... HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN ...
... human T200 show a remarkable conservation of this entire cytoplasmic region of the molecule . This almost certainly ... HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN MOUSE RAT HUMAN ...
Page 446
... human mouse human mouse human mouse human mouse human mouse human mouse human mouse human 50 90 10 30 * 70 MMDQARSAF SNL FGGEPLSYTRFSLARQVDGDNSHVEMKLAADE EENADNN KASVRKPKRENORLOF AAI ALVIFFLIGEMSGYLGYOKRVEDKEECVK MMDQARSAF SNL ...
... human mouse human mouse human mouse human mouse human mouse human mouse human mouse human 50 90 10 30 * 70 MMDQARSAF SNL FGGEPLSYTRFSLARQVDGDNSHVEMKLAADE EENADNN KASVRKPKRENORLOF AAI ALVIFFLIGEMSGYLGYOKRVEDKEECVK MMDQARSAF SNL ...
Contents
Defect in immunoregulatory intestinal epithelial cells in inflammatory | 9 |
Vasoactive intestinal peptide and the severity of colonic inflammation | 25 |
Substance P andor calcitonin generelated peptide are present | 43 |
Copyright | |
8 other sections not shown
Other editions - View all
Common terms and phrases
acid activity addition analysis animals antibodies antigen approach assay associated bacterial binding blood cell cultures changes chronic Clin clinical colon compared concentrations containing Crohn's disease culture cytotoxicity decreased demonstrated described detected determined Division effect epithelial cells examined experiments expression factor Figure function future Gastroenterology growth human immune Immunol increased incubated indicate induced infection inflammation inflammatory bowel disease inhibition intestinal isolated jejunum lamina propria levels lymph nodes lymphocytes MacDermott macrophages mean measured mechanisms mediators METHODS mice mucosal mycobacteria normal observed obtained occurred organisms patients positive prepared present previously production protein Publishers rats receptor REFERENCES release reported response role samples Science secretion sera serum showed shown significant similar specific specimens status stimulated strain studies suggest supported synthesis Table tested tissue ulcerative colitis vitro